PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G03530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 286aa    MW: 31142.9 Da    PI: 9.307
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G03530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.41.3e-29135189358
        CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      p+YVNaKQ+++I++RR +Rak+e+e+++ ++srkpylheSRh+hA+rR+RgsgGrF
  OPUNC07G03530.1 135 PIYVNAKQFNGIIRRRLARAKAEREHRV-SRSRKPYLHESRHRHAMRRARGSGGRF 189
                      9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-32131192IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.417132192IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-30135189IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-22135157IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860137157IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-22166189IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MEDTRILQDH HHHHQVLAAG RQQLQQRHHF PAMPPERHHH PPPPPGSPVM KFPIISGDSD  60
LGKDLKFHES SAPTIAAYSP LKEYQGHFEL ALGQSMVCTN FYNSDQSYGV YSPYGAHTMA  120
GRMLLPPAIS TDVGPIYVNA KQFNGIIRRR LARAKAEREH RVSRSRKPYL HESRHRHAMR  180
RARGSGGRFL NTKNAAAAAD AAPVSSGGGD HGASNKSSSA SEATRVYDDD DDMGVGGGGD  240
FHHAMGHLRS PAFFPSLAAM MDGGGGEGKW ATATPHHSCC VDLLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A7e-18135191461HAPB protein
4g92_A7e-18135191461HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173182RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054541e-116AP005454.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455F03.
GenBankAP0149631e-116AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126151e-116CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645550.11e-141PREDICTED: nuclear transcription factor Y subunit A-2
TrEMBLA0A0E0LHB70.0A0A0E0LHB7_ORYPU; Uncharacterized protein
STRINGLOC_Os07g06470.21e-140(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP146632123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.33e-26nuclear factor Y, subunit A10